Blastx matches sp|P41838|RAE1_SCHPO

BLASTX Tue Apr 9 16:59:48 EDT 1996

>sp|P41838|RAE1_SCHPO POLYA+ RNA EXPORT PROTEIN. >gi|625094 (U14951) polyA+ RNA
            export [Schizosaccharomyces pombe]
            Length = 352

  Plus Strand HSPs:

 Score = 135 (62.1 bits), Expect = 1.7e-79, Sum P(10) = 1.7e-79
 Identities = 22/47 (46%), Positives = 30/47 (63%), Frame = +2

Query: 24947 RYWDTRQQNPVHTQQLPDKCYTLSVKHPLMVVGTADRNLIVFNLQNP 25087
             +YWD RQ  P+ T  LP++ Y +   HPL+ V TA+RN+ V NL  P
Sbjct:   143 KYWDLRQSTPIATVSLPERVYAMDCVHPLLTVATAERNICVINLSEP 189

 Score = 116 (53.4 bits), Expect = 1.7e-79, Sum P(10) = 1.7e-79
 Identities = 21/36 (58%), Positives = 27/36 (75%), Frame = +1

Query: 25855 HGTFATAGSDGAFNFWDKDSKQRLKVFSSCIDFLFC 25962
             +GTF+TAGSDG F+FWDKDS QRLK + +    + C
Sbjct:   266 YGTFSTAGSDGTFSFWDKDSHQRLKSYPNVGGTISC 301

 Score = 93 (42.8 bits), Expect = 1.7e-79, Sum P(10) = 1.7e-79
 Identities = 13/29 (44%), Positives = 23/29 (79%), Frame = +1

Query: 25618 VGSIEGRVGVHHLDDSQQSKNFTFKCHRD 25704
             +GS+EGR  + ++D+   S+NF+F+CHR+
Sbjct:   218 IGSVEGRCAIQNIDEKNASQNFSFRCHRN 246

 Score = 93 (42.8 bits), Expect = 1.7e-79, Sum P(10) = 1.7e-79
 Identities = 17/32 (53%), Positives = 25/32 (78%), Frame = +2

Query: 24269 LQVTPSPADSISSLSFSPRADILVATSWDNQV 24364
             ++V   P DSIS L+FSP+A+ L A+SWD++V
Sbjct:    23 VEVAQPPEDSISDLAFSPQAEYLAASSWDSKV 54

 Score = 67 (30.8 bits), Expect = 1.7e-79, Sum P(10) = 1.7e-79
 Identities = 14/30 (46%), Positives = 18/30 (60%), Frame = +2

Query: 24641 VLCSAWKDDGTTVFSGGCDKQAKMWPLLSG 24730
             VL   W  DGT V SG  DK AK++ + +G
Sbjct:    77 VLSVNWSRDGTKVASGSVDKSAKVFDIQTG 106

 Score = 62 (28.5 bits), Expect = 1.7e-79, Sum P(10) = 1.7e-79
 Identities = 11/19 (57%), Positives = 14/19 (73%), Frame = +1

Query: 26032 IPCSSFNHDGSIYAYAV*Y 26088
             I CS+FN  G I+AYA+ Y
Sbjct:   299 ISCSTFNRTGDIFAYAISY 317

 Score = 61 (28.1 bits), Expect = 1.7e-79, Sum P(10) = 1.7e-79
 Identities = 11/12 (91%), Positives = 12/12 (100%), Frame = +2

Query: 24800 LLATGSWDKTLK 24835
             +LATGSWDKTLK
Sbjct:   132 ILATGSWDKTLK 143

 Score = 57 (26.2 bits), Expect = 1.7e-79, Sum P(10) = 1.7e-79
 Identities = 10/18 (55%), Positives = 13/18 (72%), Frame = +1

Query: 25711 DIYSVNSLNFHPVSSIYS 25764
             D+YSVNS+ FHP    +S
Sbjct:   253 DVYSVNSIAFHPQYGTFS 270

 Score = 57 (26.2 bits), Expect = 1.7e-79, Sum P(10) = 1.7e-79
 Identities = 11/26 (42%), Positives = 15/26 (57%), Frame = +3

Query: 25281 FKRIQSPLKYQTRCVTAFPDQQGFLV 25358
             FK   SPLK+QTR +  F    G+ +
Sbjct:   193 FKLAMSPLKFQTRSLACFIKGDGYAI 218

 Score = 55 (25.3 bits), Expect = 5.8e-71, Sum P(9) = 5.8e-71
 Identities = 10/27 (37%), Positives = 17/27 (62%), Frame = +2

Query: 24755 HEGPIAAMAWIPGMNLLATGSWDKTLK 24835
             H+GP+ ++ W      +A+GS DK+ K
Sbjct:    73 HQGPVLSVNWSRDGTKVASGSVDKSAK 99

 Score = 45 (20.7 bits), Expect = 1.5e-58, Sum P(8) = 1.5e-58
 Identities = 9/26 (34%), Positives = 14/26 (53%), Frame = +2

Query: 24758 EGPIAAMAWIPGMNLLATGSWDKTLK 24835
             E  I+ +A+ P    LA  SWD  ++
Sbjct:    30 EDSISDLAFSPQAEYLAASSWDSKVR 55

 Score = 43 (19.8 bits), Expect = 1.7e-79, Sum P(10) = 1.7e-79
 Identities = 9/25 (36%), Positives = 12/25 (48%), Frame = +1

Query: 26245 YDWSKGAENHNPATAKSSIFLHLPQ 26319
             YDWSKG   +N       +   +PQ
Sbjct:   317 YDWSKGYTFNNAQLPNKIMLHPVPQ 341

 Score = 39 (17.9 bits), Expect = 4.8e-52, Sum P(8) = 4.8e-52
 Identities = 9/26 (34%), Positives = 12/26 (46%), Frame = +2

Query: 24683 SGGCDKQAKMWPLLSGGQPVTVAMHE 24760
             +G  DK  K W L       TV++ E
Sbjct:   135 TGSWDKTLKYWDLRQSTPIATVSLPE 160

 Score = 37 (17.0 bits), Expect = 4.3e-05, Sum P(3) = 4.3e-05
 Identities = 11/28 (39%), Positives = 14/28 (50%), Frame = +2

Query: 26255 AKVQKITTRRLQKAAFSCTCHRCVRVTD 26338
             AKV  I T + Q+ A      RCVR  +
Sbjct:    98 AKVFDIQTGQNQQVAAHDDAVRCVRFVE 125