The following open reading frames were used in producing the candidate translation product: 7096..7782. Base positions for candidate proteins encoded on the complementary strand are listed in descending order.
Please note: Alignments are produced from Blastp result files, and may not contain the complete amino acid sequence of the matching proteins. The candidate protein sequence is the top line, Residues that are identical to the candidate protein sequence are represented with an underscore (_), non-identical residues are represented by their single letter character. Conservative substitutions are shown in a blue-green while non-conservative substitutions are in red. Blank spaces in the protein match sequences indicate the end of a high scoring segment. BLASTP Wed Apr 10 16:23:07 EDT 1996
g8261.cand.1 1 MEPSIKGDQEMLKIKKQGHQDLELGLTLLSRGTATSSELNLIDSFKTSSSSTSHHQHQQE >gi|790673 ____________________________________________________________ >gi|790677 S_H______CIDDTT_IVNESTTST_ >gi|790679 __E__NPEQ_Q__Q >gi|790675 _E_VLEPSSM___S_SSTNSSS g8261.cand.1 61 QLADPRVFSCNYCQRKFYSSQALGGHQNAHKRERTLAKRGQYYKMTLSSLPSSAFAFGHG >gi|790673 ____________________________________________________________ >gi|790677 _ EQKL________T_________________________ >gi|790679 PSVSK__________________________________AMLWVLLG__ >gi|790675 C_EQ___________________________L______KSR >gi|790685 _N_________R_____________________M___AMH g8261.cand.1 121 SVSRFASMASLPLHGSVNNRSTLGIQAHSTIHKPSFLGRQTTSLSHVFKQSIHQKPTIGK >gi|790673 ____________________________________________________________ >gi|790677 __F__QY__HRS_______IS__L_ >gi|790679 LSC______G_GNM____R___SA_DV_ >gi|790685 _S__M____ g8261.cand.1 181 MLPEKFHLEVAGNNNSNMVAAKLERIGHFKSNQEDHNQFKKIDLTLKL >gi|790673 ________________________________________________ >gi|790677 _EEQQ_L__S___
Protein match title lines
>gi|790673 (L39644) zinc finger protein [Arabidopsis thaliana]
score = 1176 p value = 8.1e-159
>gi|790677 (L39646) zinc finger protein [Arabidopsis thaliana]
score = 185 p value = 6.7e-43
>gi|790679 (L39647) zinc finger protein [Arabidopsis thaliana]
score = 218 p value = 2.6e-26
>gi|790675 (L39645) zinc finger protein [Arabidopsis thaliana]
score = 201 p value = 7.6e-22
>gi|790685 (L39650) zinc finger protein [Arabidopsis thaliana]
score = 193 p value = 1.3e-20