The following open reading frames were used in producing the candidate translation product: 27327..27383, 27458..27637. Base positions for candidate proteins encoded on the complementary strand are listed in descending order.
Please note: Alignments are produced from Blastp result files, and may not contain the complete amino acid sequence of the matching proteins. The candidate protein sequence is the top line, Residues that are identical to the candidate protein sequence are represented with an underscore (_), non-identical residues are represented by their single letter character. Conservative substitutions are shown in a blue-green while non-conservative substitutions are in red. Blank spaces in the protein match sequences indicate the end of a high scoring segment. BLASTP Wed Apr 10 16:27:51 EDT 1996
g8261.cand.4 1 MAGNKDSSWDDIKNEGIDLEKIPIEEVLTQLRCTREGLTSDEGQTRLEIFGSNKLEEKKA >pir||S50752 _AI_LEE____TV__________FE__K_S_________AN__Q___P____K_ES >sp|P19456|ATH2_ARATH __LE_____TV__________FQ__K_S_____TQ__ED_IQ___P____K_ES >sp|P20649|ATH1_ARATH _GLE_____TV__________FQ__K_______TQ__ED_IV___P____K_ES >pir||S52739 EE____AV___N______FE__K______S_S___Q______P_R__K_ES >gi|1086989 _LEQ____SV__________FA__K______S_T__ES_IQ___P____K_ES >sp|Q03194|ATH4_NICPL _AI_LEE____TV__________FE__K______SA___AS__Q___P____KNES >pir||S52728 _LEE____NV___R______FE__K_S_A_______AN__QV__P____K_ES >sp|P20431|ATH3_ARATH _GLE__V__NV__________FQ__K_S____SGA__EN__Q___P____K_ES >gi|553114 _E_PEVL_AVLK_TV___N______FEN____K____ATAA_E__S___Y____K_ES >pir||S50751 _E_PEVL_AVLK_TV___N______FEN____K____GTAA_E__A___Y____K_ES >sp|Q08435|ATH1_NICPL _GEE_PEVL_AVLK_AV___N______FEN____K____ATAA_E__A___Y____K_DS >sp|P22180|ATH1_LYCES _AVLK_TV___N______FEN_________ATAA_E__S___Y____K_ES >pir||A43637 _E_PEVL_AVLK_TV___N______FEN____K___SGPAA_E__A___Y____K_ES >gi|218179 _AVLK_SV___N______FQN_K_C_Q____E_A_L__QL__P____KEES >gi|633110 _GDNLEAVL__SV___N__L___FEH___N______ANAEQ__NL__L_R__K_ES >sp|Q08436|ATH3_NICPL _E_PEVL_AVLK_TV___N______FEN____K____ATAA_E__S___Y_______ >gi|533775 D_A_NL_AVLK_AV___N_A_Q__FES___SPQ__STEQAEQ__A___P____KQES g8261.cand.4 61 HILKYLSLFVSSLSRNSI >pir||S50752 K___F_GFMWNP__ >sp|P19456|ATH2_ARATH KL__F_GFMWNP__ >sp|P20649|ATH1_ARATH K___F_GFMWNP__ >pir||S52739 KV__F_GFMWNP__ >gi|1086989 KF__F_GFMWNP__ >sp|Q03194|ATH4_NICPL K___F_GFMWNP__ >pir||S52728 KF__F_GFMWNP__ >sp|P20431|ATH3_ARATH KL__F_GFMWNP__ >gi|553114 KF__F_GFMWNP__ >pir||S50751 KF__F_GFMWNP__ >sp|Q08435|ATH1_NICPL KL__F_GFMWNP__ >sp|P22180|ATH1_LYCES KF__F_GFMWNP__ >pir||A43637 KF__F_GFMWNP__ >gi|218179 KF__F_GFMWNP__ >gi|633110 KF__F_GFMWNP__ >gi|533775 KF__F_GFMWNP__
Protein match title lines
>pir||S50752 H+-transporting ATPase (EC 3.6.1.35) (clone PHA2) - potato score = 203 p value = 2.3e-23 >sp|P19456|ATH2_ARATH PLASMA MEMBRANE ATPASE 2 (PROTON PUMP). >pir||PXMUP2 score = 201 p value = 8.0e-23 >sp|P20649|ATH1_ARATH PLASMA MEMBRANE ATPASE 1 (PROTON PUMP). >pir||PXMUP1 score = 197 p value = 1.5e-22 >pir||S52739 H+-transporting ATPase (EC 3.6.1.35) - maize >gi|758355 (X85805) score = 196 p value = 2.8e-22 >gi|1086989 (S79323) plasma membrane H(+)-ATPase [Vicia faba, Otafuku, abaxial score = 198 p value = 4.0e-22 >sp|Q03194|ATH4_NICPL PLASMA MEMBRANE ATPASE 4 (PROTON PUMP). >pir||S24959 score = 196 p value = 1.0e-21 >pir||S52728 H+-transporting ATPase (EC 3.6.1.35) - kidney bean >gi|758250 score = 194 p value = 1.4e-21 >sp|P20431|ATH3_ARATH PLASMA MEMBRANE ATPASE 3 (PROTON PUMP). >pir||PXMUP3 score = 188 p value = 4.9e-21 >gi|553114 (M80491) plasma membrane H+ ATPase [Nicotiana plumbaginifolia] score = 166 p value = 2.2e-18 >pir||S50751 H+-transporting ATPase (EC 3.6.1.35) (clone PHA1) - potato score = 164 p value = 1.8e-17 >sp|Q08435|ATH1_NICPL PLASMA MEMBRANE ATPASE 1 (PROTON PUMP). >pir||A41779 score = 164 p value = 1.8e-17 >sp|P22180|ATH1_LYCES PLASMA MEMBRANE ATPASE 1 (PROTON PUMP). >pir||A45506 score = 163 p value = 2.5e-17 >pir||A43637 H+-transporting ATPase (EC 3.6.1.35) - curled-leaved tobacco score = 160 p value = 6.4e-17 >gi|218179 (D10207) H+-ATPase [Oryza sativa] >prf||1906387A H ATPase [Oryza score = 162 p value = 1.2e-16 >gi|633110 (D31843) Rice mRNA for plasma membrane H+-ATPase., and translated score = 158 p value = 1.2e-16 >sp|Q08436|ATH3_NICPL PLASMA MEMBRANE ATPASE 3 (PROTON PUMP). >gi|170295 score = 166 p value = 1.2e-16 >gi|533775 (U09989) H(+)-transporting ATPase [Zea mays] score = 142 p value = 6.5e-14